Lineage for d3q7ja3 (3q7j A:415-489)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766973Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2766995Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2766996Protein automated matches [254707] (4 species)
    not a true protein
  7. 2767063Species Thermoplasma acidophilum [TaxId:273075] [256034] (1 PDB entry)
  8. 2767064Domain d3q7ja3: 3q7j A:415-489 [248797]
    Other proteins in same PDB: d3q7ja1, d3q7ja2, d3q7ja4, d3q7jb1, d3q7jb2, d3q7jb4
    automated match to d1z1wa3
    complexed with fbo, zn

Details for d3q7ja3

PDB Entry: 3q7j (more details), 2.91 Å

PDB Description: Engineered Thermoplasma Acidophilum F3 factor mimics human aminopeptidase N (APN) as a target for anticancer drug development
PDB Compounds: (A:) Tricorn protease-interacting factor F3

SCOPe Domain Sequences for d3q7ja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q7ja3 b.1.30.0 (A:415-489) automated matches {Thermoplasma acidophilum [TaxId: 273075]}
gypviklkrngrkitmyqtrfllngeeegrwpvpvnikkkdgverilledeasieadgli
kinadsagfyrvlyd

SCOPe Domain Coordinates for d3q7ja3:

Click to download the PDB-style file with coordinates for d3q7ja3.
(The format of our PDB-style files is described here.)

Timeline for d3q7ja3: