![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) ![]() same topology as (b.1.15.1) |
![]() | Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
![]() | Protein automated matches [254707] (4 species) not a true protein |
![]() | Species Thermoplasma acidophilum [TaxId:273075] [256034] (1 PDB entry) |
![]() | Domain d3q7ja3: 3q7j A:415-489 [248797] Other proteins in same PDB: d3q7ja1, d3q7ja2, d3q7ja4, d3q7jb1, d3q7jb2, d3q7jb4 automated match to d1z1wa3 complexed with fbo, zn |
PDB Entry: 3q7j (more details), 2.91 Å
SCOPe Domain Sequences for d3q7ja3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q7ja3 b.1.30.0 (A:415-489) automated matches {Thermoplasma acidophilum [TaxId: 273075]} gypviklkrngrkitmyqtrfllngeeegrwpvpvnikkkdgverilledeasieadgli kinadsagfyrvlyd
Timeline for d3q7ja3:
![]() Domains from other chains: (mouse over for more information) d3q7jb1, d3q7jb2, d3q7jb3, d3q7jb4 |