Lineage for d3q6fg1 (3q6f G:2-107)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1512787Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries)
  8. 1512984Domain d3q6fg1: 3q6f G:2-107 [248788]
    Other proteins in same PDB: d3q6fa2, d3q6fc2, d3q6fe2, d3q6fg2, d3q6fi2, d3q6fk2
    automated match to d1adql1
    complexed with peg

Details for d3q6fg1

PDB Entry: 3q6f (more details), 3.19 Å

PDB Description: Crystal structure of Fab of human mAb 2909 specific for quaternary neutralizing epitope of HIV-1 gp120
PDB Compounds: (G:) Light chain of Fab of human mAb 2909

SCOPe Domain Sequences for d3q6fg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q6fg1 b.1.1.1 (G:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yvltqppsvsvapgktaritcggnnianknvhwyqqkpgqapvlviyydddrpsgipdrf
sgsnsgntatltisrveagdeadyycqvwdsnsdhvvfgggtqltvlg

SCOPe Domain Coordinates for d3q6fg1:

Click to download the PDB-style file with coordinates for d3q6fg1.
(The format of our PDB-style files is described here.)

Timeline for d3q6fg1: