Lineage for d3q6fe2 (3q6f E:108-211)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2362745Domain d3q6fe2: 3q6f E:108-211 [248787]
    Other proteins in same PDB: d3q6fa1, d3q6fc1, d3q6fe1, d3q6fg1, d3q6fi1, d3q6fk1
    automated match to d1adql2
    complexed with peg

Details for d3q6fe2

PDB Entry: 3q6f (more details), 3.19 Å

PDB Description: Crystal structure of Fab of human mAb 2909 specific for quaternary neutralizing epitope of HIV-1 gp120
PDB Compounds: (E:) Light chain of Fab of human mAb 2909

SCOPe Domain Sequences for d3q6fe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q6fe2 b.1.1.2 (E:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptec

SCOPe Domain Coordinates for d3q6fe2:

Click to download the PDB-style file with coordinates for d3q6fe2.
(The format of our PDB-style files is described here.)

Timeline for d3q6fe2: