| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (9 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
| Domain d3q6fe2: 3q6f E:108-211 [248787] Other proteins in same PDB: d3q6fa1, d3q6fc1, d3q6fe1, d3q6fg1, d3q6fi1, d3q6fk1 automated match to d1adql2 complexed with peg |
PDB Entry: 3q6f (more details), 3.19 Å
SCOPe Domain Sequences for d3q6fe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q6fe2 b.1.1.2 (E:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptec
Timeline for d3q6fe2: