SCOPe 2.08: Domain d3q6fc2: 3q6f C:108-211

Lineage for d3q6fc2 (3q6f C:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3q6fc2: 3q6f C:108-211 [248785]
   Other proteins in same PDB: d3q6fa1, d3q6fb_, d3q6fc1, d3q6fe1, d3q6fg1, d3q6fi1, d3q6fk1
   automated match to d1adql2
   complexed with peg

Details for d3q6fc2

PDB Entry: 3q6f, 3.19 Å

PDB Description: Crystal structure of Fab of human mAb 2909 specific for quaternary neutralizing epitope of HIV-1 gp120

PDB Compounds: (C:) Light chain of Fab of human mAb 2909

SCOPe Domain Sequences for d3q6fc2:

Sequence; same for both SEQRES and ATOM records:

>d3q6fc2 b.1.1.2 (C:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptec

Timeline for d3q6fc2:

• d3q6fc2 first appeared in SCOPe 2.04
  
• d3q6fc2 appears in SCOPe 2.07