Lineage for d3q6fa1 (3q6f A:2-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355178Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)
  8. 2355586Domain d3q6fa1: 3q6f A:2-107 [248782]
    Other proteins in same PDB: d3q6fa2, d3q6fc2, d3q6fe2, d3q6fg2, d3q6fi2, d3q6fk2
    automated match to d1adql1
    complexed with peg

Details for d3q6fa1

PDB Entry: 3q6f (more details), 3.19 Å

PDB Description: Crystal structure of Fab of human mAb 2909 specific for quaternary neutralizing epitope of HIV-1 gp120
PDB Compounds: (A:) Light chain of Fab of human mAb 2909

SCOPe Domain Sequences for d3q6fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q6fa1 b.1.1.1 (A:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yvltqppsvsvapgktaritcggnnianknvhwyqqkpgqapvlviyydddrpsgipdrf
sgsnsgntatltisrveagdeadyycqvwdsnsdhvvfgggtqltvlg

SCOPe Domain Coordinates for d3q6fa1:

Click to download the PDB-style file with coordinates for d3q6fa1.
(The format of our PDB-style files is described here.)

Timeline for d3q6fa1: