Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d3q6fa1: 3q6f A:2-107 [248782] Other proteins in same PDB: d3q6fa2, d3q6fc2, d3q6fe2, d3q6fg2, d3q6fi2, d3q6fk2 automated match to d1adql1 complexed with peg |
PDB Entry: 3q6f (more details), 3.19 Å
SCOPe Domain Sequences for d3q6fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q6fa1 b.1.1.1 (A:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} yvltqppsvsvapgktaritcggnnianknvhwyqqkpgqapvlviyydddrpsgipdrf sgsnsgntatltisrveagdeadyycqvwdsnsdhvvfgggtqltvlg
Timeline for d3q6fa1: