Lineage for d3q4dd2 (3q4d D:125-368)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1823470Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1823858Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1823859Protein automated matches [226923] (71 species)
    not a true protein
  7. 1824076Species Cytophaga hutchinsonii [TaxId:269798] [256030] (2 PDB entries)
  8. 1824080Domain d3q4dd2: 3q4d D:125-368 [248771]
    Other proteins in same PDB: d3q4da1, d3q4db1, d3q4dc1, d3q4dd1, d3q4de1, d3q4df1, d3q4dg1, d3q4dh1, d3q4di1
    automated match to d2p8ba2
    complexed with ala, dal, mg

Details for d3q4dd2

PDB Entry: 3q4d (more details), 3 Å

PDB Description: Crystal structure of dipeptide epimerase from Cytophaga hutchinsonii complexed with Mg and dipeptide D-Ala-L-Ala
PDB Compounds: (D:) Mandelate racemase/muconate lactonizing enzyme family; possible chloromuconate cycloisomerase

SCOPe Domain Sequences for d3q4dd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q4dd2 c.1.11.0 (D:125-368) automated matches {Cytophaga hutchinsonii [TaxId: 269798]}
kkdkiiqtdytvsidephkmaadavqikkngfeiikvkvggskeldverirmireaagds
itlridanqgwsvetaietltllepyniqhceepvsrnlytalpkirqacripimadesc
cnsfdaerliqiqacdsfnlklsksagitnalniirlaeqahmpvqvggflesrlgftaa
ahvalvskticyydfdtplmfeadpvrggivyqqrgiievpetaglgagyqkdylsglek
icin

SCOPe Domain Coordinates for d3q4dd2:

Click to download the PDB-style file with coordinates for d3q4dd2.
(The format of our PDB-style files is described here.)

Timeline for d3q4dd2: