Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Cytophaga hutchinsonii [TaxId:269798] [256029] (2 PDB entries) |
Domain d3q45f1: 3q45 F:1-124 [248756] Other proteins in same PDB: d3q45a2, d3q45b2, d3q45c2, d3q45d2, d3q45e2, d3q45f2, d3q45g2, d3q45h2, d3q45i2 automated match to d2p8ba1 complexed with dal, mg, val |
PDB Entry: 3q45 (more details), 3 Å
SCOPe Domain Sequences for d3q45f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q45f1 d.54.1.0 (F:1-124) automated matches {Cytophaga hutchinsonii [TaxId: 269798]} miitqvelykspvklkepfkislgilthannvivrihtasghigygecspfmtihgesmd tafivgqylakgligtscldivsnsllmdaiiygnsciksafnialydlaaqhaglplya flgg
Timeline for d3q45f1: