Lineage for d3q45b2 (3q45 B:125-368)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837481Species Cytophaga hutchinsonii [TaxId:269798] [256030] (2 PDB entries)
  8. 2837492Domain d3q45b2: 3q45 B:125-368 [248749]
    Other proteins in same PDB: d3q45a1, d3q45b1, d3q45c1, d3q45d1, d3q45e1, d3q45f1, d3q45g1, d3q45h1, d3q45i1
    automated match to d2p8ba2
    complexed with dal, mg, val

Details for d3q45b2

PDB Entry: 3q45 (more details), 3 Å

PDB Description: crystal structure of dipeptide epimerase from cytophaga hutchinsonii complexed with mg and dipeptide d-ala-l-val
PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme family; possible chloromuconate cycloisomerase

SCOPe Domain Sequences for d3q45b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q45b2 c.1.11.0 (B:125-368) automated matches {Cytophaga hutchinsonii [TaxId: 269798]}
kkdkiiqtdytvsidephkmaadavqikkngfeiikvkvggskeldverirmireaagds
itlridanqgwsvetaietltllepyniqhceepvsrnlytalpkirqacripimadesc
cnsfdaerliqiqacdsfnlklsksagitnalniirlaeqahmpvqvggflesrlgftaa
ahvalvskticyydfdtplmfeadpvrggivyqqrgiievpetaglgagyqkdylsglek
icin

SCOPe Domain Coordinates for d3q45b2:

Click to download the PDB-style file with coordinates for d3q45b2.
(The format of our PDB-style files is described here.)

Timeline for d3q45b2: