Lineage for d3q45b1 (3q45 B:1-124)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2191826Species Cytophaga hutchinsonii [TaxId:269798] [256029] (2 PDB entries)
  8. 2191837Domain d3q45b1: 3q45 B:1-124 [248748]
    Other proteins in same PDB: d3q45a2, d3q45b2, d3q45c2, d3q45d2, d3q45e2, d3q45f2, d3q45g2, d3q45h2, d3q45i2
    automated match to d2p8ba1
    complexed with dal, mg, val

Details for d3q45b1

PDB Entry: 3q45 (more details), 3 Å

PDB Description: crystal structure of dipeptide epimerase from cytophaga hutchinsonii complexed with mg and dipeptide d-ala-l-val
PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme family; possible chloromuconate cycloisomerase

SCOPe Domain Sequences for d3q45b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q45b1 d.54.1.0 (B:1-124) automated matches {Cytophaga hutchinsonii [TaxId: 269798]}
miitqvelykspvklkepfkislgilthannvivrihtasghigygecspfmtihgesmd
tafivgqylakgligtscldivsnsllmdaiiygnsciksafnialydlaaqhaglplya
flgg

SCOPe Domain Coordinates for d3q45b1:

Click to download the PDB-style file with coordinates for d3q45b1.
(The format of our PDB-style files is described here.)

Timeline for d3q45b1: