SCOPe 2.05: Domain d3q1ha_: 3q1h A:

Lineage for d3q1ha_ (3q1h A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (19 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [256028] (3 PDB entries)

8. Domain d3q1ha_: 3q1h A: [248743]
   automated match to d1disa_
   complexed with so4

Details for d3q1ha_

PDB Entry: 3q1h, 1.8 Å

PDB Description: Crystal Structure of Dihydrofolate Reductase from Yersinia pestis

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3q1ha_:

Sequence; same for both SEQRES and ATOM records:

>d3q1ha_ c.71.1.0 (A:) automated matches {Yersinia pestis [TaxId: 214092]}
amiisliaalaadrvigmenampwhlpadlawfkrntlnkpvimgrktfesigrplpgrl
nivissqpgtdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidae
vggdthfpdyepdewesvfsefhdadeanshsycfeilerr

Timeline for d3q1ha_:

• d3q1ha_ first appeared in SCOPe 2.04
  
• d3q1ha_ is called d3q1ha1 in SCOPe 2.06
  
• d3q1ha_ appears in the current release, SCOPe 2.08, called d3q1ha1