| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
| Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
| Protein automated matches [190777] (28 species) not a true protein |
| Species Yersinia pestis [TaxId:214092] [256028] (3 PDB entries) |
| Domain d3q1ha1: 3q1h A:1-160 [248743] Other proteins in same PDB: d3q1ha2 automated match to d1disa_ complexed with so4 |
PDB Entry: 3q1h (more details), 1.8 Å
SCOPe Domain Sequences for d3q1ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q1ha1 c.71.1.0 (A:1-160) automated matches {Yersinia pestis [TaxId: 214092]}
miisliaalaadrvigmenampwhlpadlawfkrntlnkpvimgrktfesigrplpgrln
ivissqpgtdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidaev
ggdthfpdyepdewesvfsefhdadeanshsycfeilerr
Timeline for d3q1ha1: