SCOPe 2.05: Domain d3q0wa1: 3q0w A:22-94

Lineage for d3q0wa1 (3q0w A:22-94)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (16 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [232223] (12 PDB entries)

8. Domain d3q0wa1: 3q0w A:22-94 [248741]
   Other proteins in same PDB: d3q0wa2
   automated match to d3sfia1
   complexed with gol, ll5

Details for d3q0wa1

PDB Entry: 3q0w, 1.6 Å

PDB Description: ETHR From mycobacterium tuberculosis in complex with compound BDM33066

PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d3q0wa1:

Sequence; same for both SEQRES and ATOM records:

>d3q0wa1 a.4.1.0 (A:22-94) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

Timeline for d3q0wa1:

• d3q0wa1 first appeared in SCOPe 2.04
  
• d3q0wa1 appears in SCOPe 2.06
  
• d3q0wa1 appears in the current release, SCOPe 2.08