![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
![]() | Protein automated matches [190674] (25 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [232223] (13 PDB entries) |
![]() | Domain d3q0wa1: 3q0w A:22-94 [248741] Other proteins in same PDB: d3q0wa2 automated match to d3sfia1 complexed with gol, ll5 |
PDB Entry: 3q0w (more details), 1.6 Å
SCOPe Domain Sequences for d3q0wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q0wa1 a.4.1.0 (A:22-94) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn qadmalqtlaenp
Timeline for d3q0wa1: