Class a: All alpha proteins [46456] (290 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
Protein Ethr repressor [109978] (2 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries) Uniprot P96222 22-215 |
Domain d3q0vb2: 3q0v B:95-215 [248740] Other proteins in same PDB: d3q0va1, d3q0vb1 automated match to d3g1ma2 complexed with ll4 |
PDB Entry: 3q0v (more details), 1.95 Å
SCOPe Domain Sequences for d3q0vb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q0vb2 a.121.1.1 (B:95-215) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]} adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge n
Timeline for d3q0vb2: