Lineage for d3q0ua1 (3q0u A:22-94)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2304502Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305405Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2305406Protein automated matches [190674] (22 species)
    not a true protein
  7. 2305496Species Mycobacterium tuberculosis [TaxId:1773] [232223] (13 PDB entries)
  8. 2305498Domain d3q0ua1: 3q0u A:22-94 [248735]
    Other proteins in same PDB: d3q0ua2
    automated match to d3g1ma1
    complexed with ll3

Details for d3q0ua1

PDB Entry: 3q0u (more details), 1.7 Å

PDB Description: ethr from mycobacterium tuberculosis in complex with compound bdm31379
PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d3q0ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q0ua1 a.4.1.0 (A:22-94) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

SCOPe Domain Coordinates for d3q0ua1:

Click to download the PDB-style file with coordinates for d3q0ua1.
(The format of our PDB-style files is described here.)

Timeline for d3q0ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q0ua2