![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
![]() | Family g.41.5.0: automated matches [232942] (1 protein) not a true family |
![]() | Protein automated matches [232943] (4 species) not a true protein |
![]() | Species Pyrococcus furiosus [TaxId:2261] [232944] (4 PDB entries) |
![]() | Domain d3pzab2: 3pza B:135-171 [248734] Other proteins in same PDB: d3pzaa1, d3pzab1 automated match to d3mpsa2 complexed with fe2, peo |
PDB Entry: 3pza (more details), 1.85 Å
SCOPe Domain Sequences for d3pzab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pzab2 g.41.5.0 (B:135-171) automated matches {Pyrococcus furiosus [TaxId: 2261]} eikkvyicpicgytavdeapeycpvcgapkekfvvfe
Timeline for d3pzab2: