Lineage for d3pzaa2 (3pza A:135-171)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641212Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2641489Family g.41.5.0: automated matches [232942] (1 protein)
    not a true family
  6. 2641490Protein automated matches [232943] (4 species)
    not a true protein
  7. 2641515Species Pyrococcus furiosus [TaxId:2261] [232944] (4 PDB entries)
  8. 2641518Domain d3pzaa2: 3pza A:135-171 [248732]
    Other proteins in same PDB: d3pzaa1, d3pzab1
    automated match to d3mpsa2
    complexed with fe2, peo

Details for d3pzaa2

PDB Entry: 3pza (more details), 1.85 Å

PDB Description: Fully Reduced (All-ferrous) Pyrococcus rubrerythrin after a 10 second exposure to peroxide.
PDB Compounds: (A:) rubrerythrin

SCOPe Domain Sequences for d3pzaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pzaa2 g.41.5.0 (A:135-171) automated matches {Pyrococcus furiosus [TaxId: 2261]}
eikkvyicpicgytavdeapeycpvcgapkekfvvfe

SCOPe Domain Coordinates for d3pzaa2:

Click to download the PDB-style file with coordinates for d3pzaa2.
(The format of our PDB-style files is described here.)

Timeline for d3pzaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pzaa1