Lineage for d3pzaa1 (3pza A:2-134)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2315402Protein automated matches [190041] (34 species)
    not a true protein
  7. 2316453Species Pyrococcus furiosus [TaxId:2261] [232940] (4 PDB entries)
  8. 2316456Domain d3pzaa1: 3pza A:2-134 [248731]
    Other proteins in same PDB: d3pzaa2, d3pzab2
    automated match to d3mpsa1
    complexed with fe2, peo

Details for d3pzaa1

PDB Entry: 3pza (more details), 1.85 Å

PDB Description: Fully Reduced (All-ferrous) Pyrococcus rubrerythrin after a 10 second exposure to peroxide.
PDB Compounds: (A:) rubrerythrin

SCOPe Domain Sequences for d3pzaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pzaa1 a.25.1.1 (A:2-134) automated matches {Pyrococcus furiosus [TaxId: 2261]}
vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
rkakekaekgedi

SCOPe Domain Coordinates for d3pzaa1:

Click to download the PDB-style file with coordinates for d3pzaa1.
(The format of our PDB-style files is described here.)

Timeline for d3pzaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pzaa2