Lineage for d3pxla2 (3pxl A:131-300)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772763Species Trametes hirsuta [TaxId:5327] [255835] (4 PDB entries)
  8. 2772765Domain d3pxla2: 3pxl A:131-300 [248728]
    automated match to d1kyaa2
    complexed with cu, nag

Details for d3pxla2

PDB Entry: 3pxl (more details), 1.2 Å

PDB Description: type-2 cu-depleted fungus laccase from trametes hirsuta
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d3pxla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pxla2 b.6.1.0 (A:131-300) automated matches {Trametes hirsuta [TaxId: 5327]}
dphasrydvdnddtvitladwyhtaaklgprfpggadatlingkgrapsdsvaelsvikv
tkgkryrfrlvslscnpnhtfsidghnltiievdsvnsqplevdsiqifaaqrysfvlda
nqavdnywiranpnfgnvgfdgginsailrydgapavepttnqttsvkpl

SCOPe Domain Coordinates for d3pxla2:

Click to download the PDB-style file with coordinates for d3pxla2.
(The format of our PDB-style files is described here.)

Timeline for d3pxla2: