Lineage for d3pxjc2 (3pxj C:131-230)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1764963Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255699] (2 PDB entries)
  8. 1764971Domain d3pxjc2: 3pxj C:131-230 [248724]
    automated match to d2v9ta_

Details for d3pxjc2

PDB Entry: 3pxj (more details), 2.3 Å

PDB Description: tandem ig repeats of dlar
PDB Compounds: (C:) Tyrosine-protein phosphatase Lar

SCOPe Domain Sequences for d3pxjc2:

Sequence, based on SEQRES records: (download)

>d3pxjc2 b.1.1.0 (C:131-230) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
egdktpagfpvitqgpgtrvievghtvlmtckaignptpniywiknqtkvdmsnpryslk
dgflqiensreedqgkyecvaensmgtehskatnlyvkvr

Sequence, based on observed residues (ATOM records): (download)

>d3pxjc2 b.1.1.0 (C:131-230) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ektpagfpvitqgpgtrvievghtvlmtckaignptpniywiknqtkvdmsnpryslkdg
flqiensreedqgkyecvaensmgtehskatnlyvkvr

SCOPe Domain Coordinates for d3pxjc2:

Click to download the PDB-style file with coordinates for d3pxjc2.
(The format of our PDB-style files is described here.)

Timeline for d3pxjc2: