| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255699] (2 PDB entries) |
| Domain d3pxjc1: 3pxj C:33-130 [248723] automated match to d2v9ta_ |
PDB Entry: 3pxj (more details), 2.3 Å
SCOPe Domain Sequences for d3pxjc1:
Sequence, based on SEQRES records: (download)
>d3pxjc1 b.1.1.0 (C:33-130) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ahppeiirkpqnqgvrvggvasfycaargdpppsivwrkngkkvsgtqsrytvleqpggi
silriepvragrddapyecvaengvgdavsadatltiy
>d3pxjc1 b.1.1.0 (C:33-130) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ahppeiirkpqnqgvrvggvasfycaargdpppsivwrkngkkvsrytvleqpggisilr
iepvragrddapyecvaeavsadatltiy
Timeline for d3pxjc1: