Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255699] (2 PDB entries) |
Domain d3pxja1: 3pxj A:32-130 [248719] automated match to d2v9ta_ |
PDB Entry: 3pxj (more details), 2.3 Å
SCOPe Domain Sequences for d3pxja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pxja1 b.1.1.0 (A:32-130) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} aahppeiirkpqnqgvrvggvasfycaargdpppsivwrkngkkvsgtqsrytvleqpgg isilriepvragrddapyecvaengvgdavsadatltiy
Timeline for d3pxja1: