SCOPe 2.04: Domain d3pxha1: 3pxh A:30-124

Lineage for d3pxha1 (3pxh A:30-124)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d3pxha1: 3pxh A:30-124 [248717]
   automated match to d2v9ta_
   complexed with so4

Details for d3pxha1

PDB Entry: 3pxh, 2 Å

PDB Description: tandem ig domains of tyrosine phosphatase lar

PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase F

SCOPe Domain Sequences for d3pxha1:

Sequence; same for both SEQRES and ATOM records:

>d3pxha1 b.1.1.0 (A:30-124) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dskpvfvkvpedqtglsggvasfvcqatgepkpritwmkkgkkvssqrfeviefddgags
vlriqplrvqrdeaiyectatnslgeintsaklsv

Timeline for d3pxha1:

• d3pxha1 is new in SCOPe 2.04-stable
  
• d3pxha1 appears in SCOPe 2.05
  
• d3pxha1 appears in the current release, SCOPe 2.08