SCOPe 2.07: Domain d3px4d1: 3px4 D:298-468

Lineage for d3px4d1 (3px4 D:298-468)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:1462] [233272] (8 PDB entries)

8. Domain d3px4d1: 3px4 D:298-468 [248711]
   Other proteins in same PDB: d3px4a2, d3px4d2
   automated match to d3pv8d1
   protein/DNA complex; complexed with dct, mg, so4

Details for d3px4d1

PDB Entry: 3px4, 1.58 Å

PDB Description: crystal structure of bacillus dna polymerase i large fragment bound to dna and ddctp-da mismatch (wobble) in ajar conformation

PDB Compounds: (D:) DNA polymerase I

SCOPe Domain Sequences for d3px4d1:

Sequence; same for both SEQRES and ATOM records:

>d3px4d1 c.55.3.0 (D:298-468) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
kmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpqf
vawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakmk
qyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

Timeline for d3px4d1:

• d3px4d1 first appeared in SCOPe 2.04
  
• d3px4d1 appears in SCOPe 2.06
  
• d3px4d1 appears in the current release, SCOPe 2.08