SCOPe 2.05: Domain d3pwfa2: 3pwf A:135-171

Lineage for d3pwfa2 (3pwf A:135-171)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.0: automated matches [232942] (1 protein)
   not a true family

6. Protein automated matches [232943] (3 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [232944] (4 PDB entries)

8. Domain d3pwfa2: 3pwf A:135-171 [248702]
   Other proteins in same PDB: d3pwfa1, d3pwfb1
   automated match to d3mpsa2
   complexed with fe2

Details for d3pwfa2

PDB Entry: 3pwf, 1.64 Å

PDB Description: High resolution structure of the fully reduced form of rubrerythrin from P. furiosus

PDB Compounds: (A:) rubrerythrin

SCOPe Domain Sequences for d3pwfa2:

Sequence; same for both SEQRES and ATOM records:

>d3pwfa2 g.41.5.0 (A:135-171) automated matches {Pyrococcus furiosus [TaxId: 2261]}
eikkvyicpicgytavdeapeycpvcgapkekfvvfe

Timeline for d3pwfa2:

• d3pwfa2 first appeared in SCOPe 2.04
  
• d3pwfa2 appears in SCOPe 2.06
  
• d3pwfa2 appears in the current release, SCOPe 2.08