![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
![]() | Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
![]() | Protein automated matches [226907] (28 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [256026] (1 PDB entry) |
![]() | Domain d3pwea3: 3pwe A:245-366 [248697] automated match to d4k3lb3 mutant |
PDB Entry: 3pwe (more details), 2.2 Å
SCOPe Domain Sequences for d3pwea3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pwea3 d.131.1.0 (A:245-366) automated matches {Escherichia coli K-12 [TaxId: 83333]} rrvlpknpdkhleagsdllkqafaraailsnekfrgvrlyvsenqlkitannpeqeeaee cldvtysgaemeigfnvsyvldvlnalksenvrmmltdsvssvqiedaasqsaayvvmpm rl
Timeline for d3pwea3: