Lineage for d3pwea2 (3pwe A:123-244)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977231Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2977232Protein automated matches [226907] (28 species)
    not a true protein
  7. 2977341Species Escherichia coli K-12 [TaxId:83333] [256026] (1 PDB entry)
  8. 2977343Domain d3pwea2: 3pwe A:123-244 [248696]
    automated match to d4k3la2
    mutant

Details for d3pwea2

PDB Entry: 3pwe (more details), 2.2 Å

PDB Description: crystal structure of the e. coli beta clamp mutant r103c, i305c, c260s, c333s at 2.2a resolution
PDB Compounds: (A:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d3pwea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwea2 d.131.1.0 (A:123-244) automated matches {Escherichia coli K-12 [TaxId: 83333]}
qseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavcsm
pigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgrfp
dy

SCOPe Domain Coordinates for d3pwea2:

Click to download the PDB-style file with coordinates for d3pwea2.
(The format of our PDB-style files is described here.)

Timeline for d3pwea2: