Lineage for d3pvob_ (3pvo B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1533870Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
    automatically mapped to Pfam PF00354
  6. 1533871Protein C-reactive protein (CRP) [49954] (1 species)
  7. 1533872Species Human (Homo sapiens) [TaxId:9606] [49955] (6 PDB entries)
  8. 1533919Domain d3pvob_: 3pvo B: [248676]
    automated match to d3pvna_
    complexed with ca

Details for d3pvob_

PDB Entry: 3pvo (more details), 3 Å

PDB Description: monoclinic form of human c-reactive protein
PDB Compounds: (B:) c-reactive protein

SCOPe Domain Sequences for d3pvob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pvob_ b.29.1.5 (B:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]}
qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
spnvlnwralkyevqgevftkpqlwp

SCOPe Domain Coordinates for d3pvob_:

Click to download the PDB-style file with coordinates for d3pvob_.
(The format of our PDB-style files is described here.)

Timeline for d3pvob_: