Class b: All beta proteins [48724] (177 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
Protein automated matches [190436] (8 species) not a true protein |
Species Legionella fallonii [TaxId:96230] [256025] (1 PDB entry) |
Domain d3pv4a1: 3pv4 A:243-340 [248674] automated match to d1ky9a1 complexed with cd |
PDB Entry: 3pv4 (more details), 3.1 Å
SCOPe Domain Sequences for d3pv4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pv4a1 b.36.1.0 (A:243-340) automated matches {Legionella fallonii [TaxId: 96230]} ihrglmgifvqhltpelaqamgypedfqgalvsqvnpnspaelaglkagdiitqindtki tqatqvkttisllrvgstvkiiverdnkpltlsavvtd
Timeline for d3pv4a1: