Lineage for d3pv4a1 (3pv4 A:243-340)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2056344Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2056345Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2056880Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2056881Protein automated matches [190436] (8 species)
    not a true protein
  7. 2057059Species Legionella fallonii [TaxId:96230] [256025] (1 PDB entry)
  8. 2057060Domain d3pv4a1: 3pv4 A:243-340 [248674]
    automated match to d1ky9a1
    complexed with cd

Details for d3pv4a1

PDB Entry: 3pv4 (more details), 3.1 Å

PDB Description: Structure of Legionella fallonii DegQ (Delta-PDZ2 variant)
PDB Compounds: (A:) DegQ

SCOPe Domain Sequences for d3pv4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pv4a1 b.36.1.0 (A:243-340) automated matches {Legionella fallonii [TaxId: 96230]}
ihrglmgifvqhltpelaqamgypedfqgalvsqvnpnspaelaglkagdiitqindtki
tqatqvkttisllrvgstvkiiverdnkpltlsavvtd

SCOPe Domain Coordinates for d3pv4a1:

Click to download the PDB-style file with coordinates for d3pv4a1.
(The format of our PDB-style files is described here.)

Timeline for d3pv4a1: