Lineage for d1djrf_ (1djr F:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2381771Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2381772Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 protein domains)
  6. 2381917Protein Heat-labile toxin [50205] (2 species)
  7. 2381918Species Escherichia coli, type IB [TaxId:562] [50206] (22 PDB entries)
  8. 2381921Domain d1djrf_: 1djr F: [24867]
    complexed with bez, gla, gol

Details for d1djrf_

PDB Entry: 1djr (more details), 1.3 Å

PDB Description: heat-labile enterotoxin b-pentamer complexed with m-carboxyphenyl-alpha-d-galactose
PDB Compounds: (F:) heat-labile enterotoxin

SCOPe Domain Sequences for d1djrf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djrf_ b.40.2.1 (F:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOPe Domain Coordinates for d1djrf_:

Click to download the PDB-style file with coordinates for d1djrf_.
(The format of our PDB-style files is described here.)

Timeline for d1djrf_: