Lineage for d3pu1e_ (3pu1 E:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1509522Fold a.260: Rhabdovirus nucleoprotein-like [140808] (1 superfamily)
    multihelical, consist of two helical domains; each domain contains a buried helix
  4. 1509523Superfamily a.260.1: Rhabdovirus nucleoprotein-like [140809] (1 family) (S)
    automatically mapped to Pfam PF00945
  5. 1509524Family a.260.1.1: Rhabdovirus nucleocapsid protein [140810] (2 proteins)
    Pfam PF00945; RNA-binding homooligomeric protein
  6. 1509525Protein Nucleoprotein [140811] (2 species)
  7. 1509549Species Vesicular stomatitis indiana virus [TaxId:11277] [140813] (4 PDB entries)
    Uniprot P03521 2-422
  8. 1509569Domain d3pu1e_: 3pu1 E: [248653]
    automated match to d2gica1
    protein/RNA complex; complexed with ium

Details for d3pu1e_

PDB Entry: 3pu1 (more details), 3.14 Å

PDB Description: crystal structure of a vesicular stomatitis virus nucleocapsid-polyg complex
PDB Compounds: (E:) nucleoprotein

SCOPe Domain Sequences for d3pu1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pu1e_ a.260.1.1 (E:) Nucleoprotein {Vesicular stomatitis indiana virus [TaxId: 11277]}
svtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglks
gnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdgv
sdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrdi
fdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgms
tedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspyssvknpafhfwg
qltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpddst
gglttnappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksefd
k

SCOPe Domain Coordinates for d3pu1e_:

Click to download the PDB-style file with coordinates for d3pu1e_.
(The format of our PDB-style files is described here.)

Timeline for d3pu1e_: