Lineage for d3ps5a3 (3ps5 A:216-529)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483040Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2483041Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2483697Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2483698Protein automated matches [190475] (10 species)
    not a true protein
  7. 2483713Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries)
  8. 2483899Domain d3ps5a3: 3ps5 A:216-529 [248639]
    Other proteins in same PDB: d3ps5a1, d3ps5a2
    automated match to d2shpa1
    complexed with so4

Details for d3ps5a3

PDB Entry: 3ps5 (more details), 3.1 Å

PDB Description: Crystal structure of the full-length Human Protein Tyrosine Phosphatase SHP-1
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 6

SCOPe Domain Sequences for d3ps5a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ps5a3 c.45.1.0 (A:216-529) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trvnaadienrvlelnkkqesedtakagfweefeslqkqevknlhqrlegqrpenkgknr
yknilpfdhsrvilqgrdsnipgsdyinanyiknqllgpdenaktyiasqgcleatvndf
wqmawqensrvivmttrevekgrnkcvpywpevgmqraygpysvtncgehdtteyklrtl
qvspldngdlireiwhyqylswpdhgvpsepggvlsfldqinqrqeslphagpiivhssa
gigrtgtiividmlmenistkgldcdidiqktiqmvraqrsgmvqteaqykfiyvaiaqf
iettkkklevlqsq

SCOPe Domain Coordinates for d3ps5a3:

Click to download the PDB-style file with coordinates for d3ps5a3.
(The format of our PDB-style files is described here.)

Timeline for d3ps5a3: