SCOPe 2.08: Domain d3ps5a3: 3ps5 A:216-529

Lineage for d3ps5a3 (3ps5 A:216-529)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries)

8. Domain d3ps5a3: 3ps5 A:216-529 [248639]
   Other proteins in same PDB: d3ps5a1, d3ps5a2
   automated match to d2shpa1
   complexed with so4

Details for d3ps5a3

PDB Entry: 3ps5, 3.1 Å

PDB Description: Crystal structure of the full-length Human Protein Tyrosine Phosphatase SHP-1

PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 6

SCOPe Domain Sequences for d3ps5a3:

Sequence; same for both SEQRES and ATOM records:

>d3ps5a3 c.45.1.0 (A:216-529) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trvnaadienrvlelnkkqesedtakagfweefeslqkqevknlhqrlegqrpenkgknr
yknilpfdhsrvilqgrdsnipgsdyinanyiknqllgpdenaktyiasqgcleatvndf
wqmawqensrvivmttrevekgrnkcvpywpevgmqraygpysvtncgehdtteyklrtl
qvspldngdlireiwhyqylswpdhgvpsepggvlsfldqinqrqeslphagpiivhssa
gigrtgtiividmlmenistkgldcdidiqktiqmvraqrsgmvqteaqykfiyvaiaqf
iettkkklevlqsq

Timeline for d3ps5a3:

• d3ps5a3 first appeared in SCOPe 2.04
  
• d3ps5a3 appears in SCOPe 2.07