SCOPe 2.07: Domain d3ps5a1: 3ps5 A:1-108

Lineage for d3ps5a1 (3ps5 A:1-108)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (78 PDB entries)

8. Domain d3ps5a1: 3ps5 A:1-108 [248637]
   Other proteins in same PDB: d3ps5a3
   automated match to d2shpa2
   complexed with so4

Details for d3ps5a1

PDB Entry: 3ps5, 3.1 Å

PDB Description: Crystal structure of the full-length Human Protein Tyrosine Phosphatase SHP-1

PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 6

SCOPe Domain Sequences for d3ps5a1:

Sequence; same for both SEQRES and ATOM records:

>d3ps5a1 d.93.1.0 (A:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvrwfhrdlsgldaetllkgrgvhgsflarpsrknqgdfslsvrvgdqvthiriqnsgdf
ydlyggekfatltelveyytqqqgvlqdrdgtiihlkyplncsdptse

Timeline for d3ps5a1:

• d3ps5a1 first appeared in SCOPe 2.04
  
• d3ps5a1 appears in SCOPe 2.06
  
• d3ps5a1 appears in the current release, SCOPe 2.08