Lineage for d3ps5a1 (3ps5 A:1-108)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965705Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2965706Protein automated matches [190561] (4 species)
    not a true protein
  7. 2965707Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)
  8. 2965842Domain d3ps5a1: 3ps5 A:1-108 [248637]
    Other proteins in same PDB: d3ps5a3
    automated match to d2shpa2
    complexed with so4

Details for d3ps5a1

PDB Entry: 3ps5 (more details), 3.1 Å

PDB Description: Crystal structure of the full-length Human Protein Tyrosine Phosphatase SHP-1
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 6

SCOPe Domain Sequences for d3ps5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ps5a1 d.93.1.0 (A:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvrwfhrdlsgldaetllkgrgvhgsflarpsrknqgdfslsvrvgdqvthiriqnsgdf
ydlyggekfatltelveyytqqqgvlqdrdgtiihlkyplncsdptse

SCOPe Domain Coordinates for d3ps5a1:

Click to download the PDB-style file with coordinates for d3ps5a1.
(The format of our PDB-style files is described here.)

Timeline for d3ps5a1: