Lineage for d1nsns_ (1nsn S:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 296801Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 296802Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein)
    barrel, closed; n=5, S=10
  6. 296803Protein Staphylococcal nuclease [50201] (1 species)
  7. 296804Species Staphylococcus aureus [TaxId:1280] [50202] (59 PDB entries)
  8. 296857Domain d1nsns_: 1nsn S: [24863]
    Other proteins in same PDB: d1nsnh1, d1nsnh2, d1nsnl1, d1nsnl2

Details for d1nsns_

PDB Entry: 1nsn (more details), 2.9 Å

PDB Description: the crystal structure of antibody n10-staphylococcal nuclease complex at 2.9 angstroms resolution
PDB Compounds: (S:)

SCOP Domain Sequences for d1nsns_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nsns_ b.40.1.1 (S:) Staphylococcal nuclease {Staphylococcus aureus}
tkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftk
kmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheq
hlrkseaqakkeklniws

SCOP Domain Coordinates for d1nsns_:

Click to download the PDB-style file with coordinates for d1nsns_.
(The format of our PDB-style files is described here.)

Timeline for d1nsns_: