Lineage for d3prhb_ (3prh B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (50 species)
    not a true protein
  7. 2106037Species Bacillus subtilis [TaxId:1423] [256024] (1 PDB entry)
  8. 2106039Domain d3prhb_: 3prh B: [248628]
    automated match to d2yy5b_
    mutant

Details for d3prhb_

PDB Entry: 3prh (more details), 2.8 Å

PDB Description: tryptophanyl-tRNA synthetase Val144Pro mutant from B. subtilis
PDB Compounds: (B:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d3prhb_:

Sequence, based on SEQRES records: (download)

>d3prhb_ c.26.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
kqtifsgiqpsgsvtlgnyigamkqfvelqhdynsyfcivdqhaitvpqdrlelrknirn
laalylavgldpekatlfiqsevpahaqagwmmqcvayigelermtqfkdkskgneavvs
glltypplmaadillygtdlvppgedqkqhleltrnlaerfnkkyndiftipevkipkvg
arimslndplkkmsksdpnqkayitlldepkqlekkiksavtdsegivkfdkenkpgvsn
lltiysilgnttieeleakyegkgygefkgdlaevvvnalkpiqdryyelieseeldril
degaeranrtankmlkkmenamglgr

Sequence, based on observed residues (ATOM records): (download)

>d3prhb_ c.26.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
kqtifsgiqpsgsvtlgnyigamkqfvelqhdynsyfcivdqhaitvpqdrlelrknirn
laalylavgldpekatlfiqsevpahaqagwmmqcvayigelermvsglltypplmaadi
llygtdlvppgedqkqhleltrnlaerfnkkyndiftipevkiarimslndplkkmsksd
pnqkayitlldepkqlekkiksavtdsegivkfdkenkpgvsnlltiysilgnttieele
akyegkgygefkgdlaevvvnalkpiqdryyelieseeldrildegaeranrtankmlkk
menamglgr

SCOPe Domain Coordinates for d3prhb_:

Click to download the PDB-style file with coordinates for d3prhb_.
(The format of our PDB-style files is described here.)

Timeline for d3prhb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3prha_