Lineage for d1ena__ (1ena -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) 
Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein) Protein Staphylococcal nuclease [50201] (1 species) Species Staphylococcus aureus [TaxId:1280] [50202] (52 PDB entries) 
Domain d1ena__: 1ena - [24862]
Details for d1ena__
PDB Entry: 1ena (more details), 2.15 Å
PDB Description: crystal structures of the binary ca2+ and pdtp complexes and the ternary complex of the asp 21->glu mutant of staphylococcal nuclease. implications for catalysis and ligand binding
SCOP Domain Sequences for d1ena__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ena__ b.40.1.1 (-) Staphylococcal nuclease {Staphylococcus aureus}
lhkepatlikaidgetvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
kseaqakkeklniws
SCOP Domain Coordinates for d1ena__:
Click to download the PDB-style file with coordinates for d1ena__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ena__:
- d1ena__ appears in SCOP 1.57
- d1ena__ appears in the current release, SCOPe 2.08, called d1enaa_
View in 3D