SCOPe 2.08: Domain d3pq7c2: 3pq7 C:598-753

Lineage for d3pq7c2 (3pq7 C:598-753)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (23 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [226043] (19 PDB entries)

8. Domain d3pq7c2: 3pq7 C:598-753 [248612]
   Other proteins in same PDB: d3pq7a1, d3pq7b1, d3pq7c1, d3pq7d1
   automated match to d3p9qb2
   complexed with h2s, hdd, hde

Details for d3pq7c2

PDB Entry: 3pq7, 1.8 Å

PDB Description: structure of i274c variant of e. coli kate[] - images 31-36

PDB Compounds: (C:) catalase hpii

SCOPe Domain Sequences for d3pq7c2:

Sequence; same for both SEQRES and ATOM records:

>d3pq7c2 c.23.16.0 (C:598-753) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpagniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

Timeline for d3pq7c2:

• d3pq7c2 first appeared in SCOPe 2.04
  
• d3pq7c2 appears in SCOPe 2.07