| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
| Protein automated matches [190197] (23 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [226043] (19 PDB entries) |
| Domain d3pq6b2: 3pq6 B:598-753 [248602] Other proteins in same PDB: d3pq6a1, d3pq6b1, d3pq6c1, d3pq6d1 automated match to d3p9qb2 complexed with h2s, hdd, hde |
PDB Entry: 3pq6 (more details), 1.8 Å
SCOPe Domain Sequences for d3pq6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pq6b2 c.23.16.0 (B:598-753) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpagniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa
Timeline for d3pq6b2: