Lineage for d2snsa_ (2sns A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540030Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 1540031Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 1540032Protein Staphylococcal nuclease [50201] (1 species)
  7. 1540033Species Staphylococcus aureus [TaxId:1280] [50202] (197 PDB entries)
    Uniprot P00644 89-223
  8. 1540210Domain d2snsa_: 2sns A: [24860]
    complexed with ca, thp

Details for d2snsa_

PDB Entry: 2sns (more details), 1.5 Å

PDB Description: staphylococcal nuclease. proposed mechanism of action based on structure of enzyme-thymidine 3(prime),5(prime)-biphosphate-calcium ion complex at 1.5-angstroms resolution
PDB Compounds: (A:) thermonuclease precursor

SCOPe Domain Sequences for d2snsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2snsa_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
ftkkmvenakkievefnkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
heqhlrkseaqakkeklniws

SCOPe Domain Coordinates for d2snsa_:

Click to download the PDB-style file with coordinates for d2snsa_.
(The format of our PDB-style files is described here.)

Timeline for d2snsa_: