Lineage for d2sns__ (2sns -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) 
Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein) Protein Staphylococcal nuclease [50201] (1 species) Species Staphylococcus aureus [TaxId:1280] [50202] (56 PDB entries) 
Domain d2sns__: 2sns - [24860]
Details for d2sns__
PDB Entry: 2sns (more details), 1.5 Å
PDB Description: staphylococcal nuclease. proposed mechanism of action based on structure of enzyme-thymidine 3(prime),5(prime)-biphosphate-calcium ion complex at 1.5-angstroms resolution
SCOP Domain Sequences for d2sns__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sns__ b.40.1.1 (-) Staphylococcal nuclease {Staphylococcus aureus}
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
ftkkmvenakkievefnkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
heqhlrkseaqakkeklniws
SCOP Domain Coordinates for d2sns__:
Click to download the PDB-style file with coordinates for d2sns__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2sns__:
- d2sns__ first appeared (with stable ids) in SCOP 1.55
- d2sns__ appears in SCOP 1.59
- d2sns__ appears in the current release, SCOPe 2.08, called d2snsa_
View in 3D