Lineage for d3pq5c1 (3pq5 C:28-597)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570066Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 2570067Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 2570068Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 2570220Protein automated matches [190051] (6 species)
    not a true protein
  7. 2570242Species Escherichia coli K-12 [TaxId:83333] [226042] (19 PDB entries)
  8. 2570309Domain d3pq5c1: 3pq5 C:28-597 [248595]
    Other proteins in same PDB: d3pq5a2, d3pq5b2, d3pq5c2, d3pq5d2
    automated match to d3p9qb1
    complexed with h2s, hdd, hde

Details for d3pq5c1

PDB Entry: 3pq5 (more details), 1.8 Å

PDB Description: structure of i274c variant of e. coli kate[] - images 19-24
PDB Compounds: (C:) catalase hpii

SCOPe Domain Sequences for d3pq5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pq5c1 e.5.1.1 (C:28-597) automated matches {Escherichia coli K-12 [TaxId: 83333]}
slapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvr
iaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsdi
tkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiff
iqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsyr
tmegfgchtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaie
agdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaene
qaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptapyhnfqrdg
mhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyysh
prlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgielt
ddqlnitpppdvnglkkdpslslyaipdgd

SCOPe Domain Coordinates for d3pq5c1:

Click to download the PDB-style file with coordinates for d3pq5c1.
(The format of our PDB-style files is described here.)

Timeline for d3pq5c1: