Class b: All beta proteins [48724] (165 folds) |
Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) |
Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein) barrel, closed; n=5, S=10 |
Protein Staphylococcal nuclease [50201] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [50202] (68 PDB entries) |
Domain d2enba_: 2enb A: [24859] complexed with ptp; mutant |
PDB Entry: 2enb (more details), 2.05 Å
SCOP Domain Sequences for d2enba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2enba_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]} lhkepatlikaidgetvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr kseaqakkeklniws
Timeline for d2enba_: