Lineage for d3pq4c2 (3pq4 C:598-753)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2117752Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2118193Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2118194Protein automated matches [190197] (20 species)
    not a true protein
  7. 2118209Species Escherichia coli K-12 [TaxId:83333] [226043] (19 PDB entries)
  8. 2118256Domain d3pq4c2: 3pq4 C:598-753 [248588]
    Other proteins in same PDB: d3pq4a1, d3pq4b1, d3pq4c1, d3pq4d1
    automated match to d3p9qb2
    complexed with h2s, hdd, hde

Details for d3pq4c2

PDB Entry: 3pq4 (more details), 1.79 Å

PDB Description: structure of i274c variant of e. coli kate[] - images 13-18
PDB Compounds: (C:) catalase hpii

SCOPe Domain Sequences for d3pq4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pq4c2 c.23.16.0 (C:598-753) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpagniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

SCOPe Domain Coordinates for d3pq4c2:

Click to download the PDB-style file with coordinates for d3pq4c2.
(The format of our PDB-style files is described here.)

Timeline for d3pq4c2: