Lineage for d1eyaa_ (1eya A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1123682Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 1123683Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 1123684Protein Staphylococcal nuclease [50201] (1 species)
  7. 1123685Species Staphylococcus aureus [TaxId:1280] [50202] (166 PDB entries)
    Uniprot P00644 89-223
  8. 1123813Domain d1eyaa_: 1eya A: [24857]
    mutant

Details for d1eyaa_

PDB Entry: 1eya (more details), 2 Å

PDB Description: structure of s. nuclease stabilizing quintuple mutant t33v/t41i/p117g/h124l/s128a
PDB Compounds: (A:) staphylococcal nuclease

SCOPe Domain Sequences for d1eyaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eyaa_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvklmykgqpmvfrlllvdipetkhpkkgvekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
kaeaqakkeklniws

SCOPe Domain Coordinates for d1eyaa_:

Click to download the PDB-style file with coordinates for d1eyaa_.
(The format of our PDB-style files is described here.)

Timeline for d1eyaa_: