Lineage for d1eyaa_ (1eya A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13575Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 13576Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein)
  6. 13577Protein Staphylococcal nuclease [50201] (1 species)
  7. 13578Species Staphylococcus aureus [TaxId:1280] [50202] (52 PDB entries)
  8. 13622Domain d1eyaa_: 1eya A: [24857]

Details for d1eyaa_

PDB Entry: 1eya (more details), 2 Å

PDB Description: structure of s. nuclease stabilizing quintuple mutant t33v/t41i/p117g/h124l/s128a

SCOP Domain Sequences for d1eyaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eyaa_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus}
lhkepatlikaidgdtvklmykgqpmvfrlllvdipetkhpkkgvekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
kaeaqakkeklniws

SCOP Domain Coordinates for d1eyaa_:

Click to download the PDB-style file with coordinates for d1eyaa_.
(The format of our PDB-style files is described here.)

Timeline for d1eyaa_: