Lineage for d3ppsd2 (3pps D:164-343)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1775547Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 1775548Protein automated matches [190824] (21 species)
    not a true protein
  7. 1775842Species Thielavia arenaria [TaxId:113610] [256023] (1 PDB entry)
  8. 1775853Domain d3ppsd2: 3pps D:164-343 [248565]
    automated match to d2q9oa2
    complexed with cu, nag, oxy

Details for d3ppsd2

PDB Entry: 3pps (more details), 2.5 Å

PDB Description: crystal structure of an ascomycete fungal laccase from thielavia arenaria
PDB Compounds: (D:) laccase

SCOPe Domain Sequences for d3ppsd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ppsd2 b.6.1.0 (D:164-343) automated matches {Thielavia arenaria [TaxId: 113610]}
ydidlgvfplmdyyyrsadelvhftqsngappsdnvlfngtarhpetgagqwynvtltpg
krhrlriintstdnhfqvslvghnmtviatdmvpvnaftvsslflavgqrydvtidansp
vgnywfnvtfgdglcgssnnkfpaaifryqgapatlptdqglpvpnhmcldnlnltpvvt

SCOPe Domain Coordinates for d3ppsd2:

Click to download the PDB-style file with coordinates for d3ppsd2.
(The format of our PDB-style files is described here.)

Timeline for d3ppsd2: