Class b: All beta proteins [48724] (176 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (21 species) not a true protein |
Species Thielavia arenaria [TaxId:113610] [256023] (1 PDB entry) |
Domain d3ppsd2: 3pps D:164-343 [248565] automated match to d2q9oa2 complexed with cu, nag, oxy |
PDB Entry: 3pps (more details), 2.5 Å
SCOPe Domain Sequences for d3ppsd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ppsd2 b.6.1.0 (D:164-343) automated matches {Thielavia arenaria [TaxId: 113610]} ydidlgvfplmdyyyrsadelvhftqsngappsdnvlfngtarhpetgagqwynvtltpg krhrlriintstdnhfqvslvghnmtviatdmvpvnaftvsslflavgqrydvtidansp vgnywfnvtfgdglcgssnnkfpaaifryqgapatlptdqglpvpnhmcldnlnltpvvt
Timeline for d3ppsd2: